Lineage for d3q9cf_ (3q9c F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000147Protein automated matches [190420] (9 species)
    not a true protein
  7. 3000185Species Momordica balsamina [TaxId:3672] [189375] (73 PDB entries)
  8. 3000264Domain d3q9cf_: 3q9c F: [306302]
    automated match to d4zuoa_
    complexed with k, na, q9c, zn

Details for d3q9cf_

PDB Entry: 3q9c (more details), 2.3 Å

PDB Description: Crystal Structure of H159A APAH complexed with N8-acetylspermidine
PDB Compounds: (F:) Acetylpolyamine amidohydrolase

SCOPe Domain Sequences for d3q9cf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q9cf_ d.165.1.1 (F:) automated matches {Momordica balsamina [TaxId: 3672]}
mrvifsedhklrnaktelyggelvppfeapfraewilaavkeagfddvvaparhgletvl
kvhdagylnfletawdrwkaagykgeaiatsfpvrrtspriptdiegqigyycnaaetai
spgtweaalssmasaidgadliaaghkaafslcrppghaagidmfggycfinnaavaaqr
lldkgakkiaildvdfhhgngtqdifyergdvffaslhgdpaeafphflgyaeetgkgag
agttanypmgrgtpysvwgealtdslkriaafgaeaivvslgvdtfeqdpisffkltspd
yitmgrtiaasgvpllvvmeggygvpeiglnvanvlkgvag

SCOPe Domain Coordinates for d3q9cf_:

Click to download the PDB-style file with coordinates for d3q9cf_.
(The format of our PDB-style files is described here.)

Timeline for d3q9cf_: