Lineage for d3q9bi_ (3q9b I:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233472Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2233473Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2233474Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2233636Protein automated matches [190420] (8 species)
    not a true protein
  7. 2233663Species Momordica balsamina [TaxId:3672] [189375] (74 PDB entries)
  8. 2233724Domain d3q9bi_: 3q9b I: [306293]
    automated match to d4zuoa_
    complexed with b3n, dms, k, na, zn

Details for d3q9bi_

PDB Entry: 3q9b (more details), 2.25 Å

PDB Description: Crystal Structure of APAH complexed with M344
PDB Compounds: (I:) Acetylpolyamine amidohydrolase

SCOPe Domain Sequences for d3q9bi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q9bi_ d.165.1.1 (I:) automated matches {Momordica balsamina [TaxId: 3672]}
mrvifsedhklrnaktelyggelvppfeapfraewilaavkeagfddvvaparhgletvl
kvhdagylnfletawdrwkaagykgeaiatsfpvrrtspriptdiegqigyycnaaetai
spgtweaalssmasaidgadliaaghkaafslcrppghhagidmfggycfinnaavaaqr
lldkgakkiaildvdfhhgngtqdifyergdvffaslhgdpaeafphflgyaeetgkgag
agttanypmgrgtpysvwgealtdslkriaafgaeaivvslgvdtfeqdpisffkltspd
yitmgrtiaasgvpllvvmeggygvpeiglnvanvlkgvag

SCOPe Domain Coordinates for d3q9bi_:

Click to download the PDB-style file with coordinates for d3q9bi_.
(The format of our PDB-style files is described here.)

Timeline for d3q9bi_: