![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
![]() | Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) ![]() this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains |
![]() | Family c.4.1.2: D-aminoacid oxidase, N-terminal domain [51979] (1 protein) This family is probably related to the FAD-linked reductases and shares with them the C-terminal domain fold |
![]() | Protein D-aminoacid oxidase, N-terminal domain [51980] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [51981] (6 PDB entries) |
![]() | Domain d1kifb1: 1kif B:1-194,B:288-339 [30622] Other proteins in same PDB: d1kifa2, d1kifb2, d1kifc2, d1kifd2, d1kife2, d1kiff2, d1kifg2, d1kifh2 complexed with bez, fad |
PDB Entry: 1kif (more details), 2.6 Å
SCOPe Domain Sequences for d1kifb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kifb1 c.4.1.2 (B:1-194,B:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin ctgvwagvlqpdplXqvrlereqlrfgssntevihnyghggygltihwgcalevaklfgk vleernl
Timeline for d1kifb1: