Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains |
Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins) |
Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [51978] (9 PDB entries) |
Domain d1h7wb4: 1h7w B:184-287,B:441-532 [30610] Other proteins in same PDB: d1h7wa1, d1h7wa2, d1h7wa3, d1h7wa5, d1h7wb1, d1h7wb2, d1h7wb3, d1h7wb5, d1h7wc1, d1h7wc2, d1h7wc3, d1h7wc5, d1h7wd1, d1h7wd2, d1h7wd3, d1h7wd5 complexed with fad, fmn, sf4 |
PDB Entry: 1h7w (more details), 1.9 Å
SCOPe Domain Sequences for d1h7wb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7wb4 c.4.1.1 (B:184-287,B:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv sakpelplfytpvdlvd
Timeline for d1h7wb4:
View in 3D Domains from same chain: (mouse over for more information) d1h7wb1, d1h7wb2, d1h7wb3, d1h7wb5 |