![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species) includes linker from domain 4 |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [54892] (9 PDB entries) |
![]() | Domain d1h7wd5: 1h7w D:845-1019 [39010] Other proteins in same PDB: d1h7wa1, d1h7wa2, d1h7wa3, d1h7wa4, d1h7wb1, d1h7wb2, d1h7wb3, d1h7wb4, d1h7wc1, d1h7wc2, d1h7wc3, d1h7wc4, d1h7wd1, d1h7wd2, d1h7wd3, d1h7wd4 complexed with fad, fmn, sf4 |
PDB Entry: 1h7w (more details), 1.9 Å
SCOPe Domain Sequences for d1h7wd5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7wd5 d.58.1.5 (D:845-1019) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpl
Timeline for d1h7wd5:
![]() Domains from same chain: (mouse over for more information) d1h7wd1, d1h7wd2, d1h7wd3, d1h7wd4 |