Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [311317] (1 PDB entry) |
Domain d3mufa_: 3muf A: [305984] automated match to d4y0aa_ complexed with adp, s3p |
PDB Entry: 3muf (more details), 2.3 Å
SCOPe Domain Sequences for d3mufa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mufa_ c.37.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]} qhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfek nlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqkerekrpllnn ltqakelfekrqalyeknasfiidargglnnslkqvlqfi
Timeline for d3mufa_: