SCOPe 2.06: Domain d3mufa_: 3muf A:

Lineage for d3mufa_ (3muf A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [311317] (1 PDB entry)

8. Domain d3mufa_: 3muf A: [305984]
   automated match to d4y0aa_
   complexed with adp, s3p

Details for d3mufa_

PDB Entry: 3muf, 2.3 Å

PDB Description: Shikimate kinase from Helicobacter pylori in complex with shikimate-3-phosphate and ADP

PDB Compounds: (A:) Shikimate kinase

SCOPe Domain Sequences for d3mufa_:

Sequence; same for both SEQRES and ATOM records:

>d3mufa_ c.37.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
qhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfek
nlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqkerekrpllnn
ltqakelfekrqalyeknasfiidargglnnslkqvlqfi

Timeline for d3mufa_:

• d3mufa_ is new in SCOPe 2.06-stable
  
• d3mufa_ appears in SCOPe 2.07
  
• d3mufa_ appears in the current release, SCOPe 2.08