SCOPe 2.06: Domain d3lzna_: 3lzn A:

Lineage for d3lzna_ (3lzn A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families)
   Pfam PF10634

5. Family b.1.33.0: automated matches [310673] (1 protein)
   not a true family

6. Protein automated matches [310872] (2 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:354242] [311313] (8 PDB entries)

8. Domain d3lzna_: 3lzn A: [305907]
   automated match to d2o6cb_
   complexed with so4, zn

Details for d3lzna_

PDB Entry: 3lzn, 1.59 Å

PDB Description: Crystal Structure Analysis of the apo P19 protein from Campylobacter jejuni at 1.59 A at pH 9

PDB Compounds: (A:) P19 protein

SCOPe Domain Sequences for d3lzna_:

Sequence; same for both SEQRES and ATOM records:

>d3lzna_ b.1.33.0 (A:) automated matches {Campylobacter jejuni [TaxId: 354242]}
gevpigdpkelngmeiaavylqpiemeprgidlaasladihleadihalknnpngfpegf
wmpyltiayelkntdtgaikrgtlmpmvaddgphyganiamekdkkggfgvgnyeltfyi
snpekqgfgrhvdeetgvgkwfepfkvdykfkytgtpk

Timeline for d3lzna_:

• d3lzna_ is new in SCOPe 2.06-stable
  
• d3lzna_ appears in SCOPe 2.07
  
• d3lzna_ appears in the current release, SCOPe 2.08