SCOP 1.65: Domain d1bhy_2: 1bhy 276-400

Lineage for d1bhy_2 (1bhy 276-400)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (11 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Dihydrolipoamide dehydrogenase [51959] (7 species)

7. Species Neisseria meningitidis [TaxId:487] [51964] (2 PDB entries)

8. Domain d1bhy_2: 1bhy 276-400 [30584]
   Other proteins in same PDB: d1bhy_3
   complexed with fad

Details for d1bhy_2

PDB Entry: 1bhy, 4.18 Å

PDB Description: low temperature middle resolution structure of p64k from masc data

SCOP Domain Sequences for d1bhy_2:

Sequence; same for both SEQRES and ATOM records:

>d1bhy_2 c.3.1.5 (276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis}
vtklpfipedpriidssgalalkevpgklliigggiiglemgtvystlgsrldvvemmdg
lmqgadrdlvkvwqkqneyrfdnimvntktvavepkedgvyvtfeganapkepqrydavl
vaagr

Timeline for d1bhy_2:

• d1bhy_2 first appeared (with stable ids) in SCOP 1.55
  
• d1bhy_2 appears in SCOP 1.63
  
• d1bhy_2 appears in SCOP 1.67
  
• d1bhy_2 appears in the current release, SCOPe 2.08, called d1bhya2