Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (11 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein Dihydrolipoamide dehydrogenase [51959] (7 species) |
Species Neisseria meningitidis [TaxId:487] [51964] (2 PDB entries) |
Domain d1bhy_2: 1bhy 276-400 [30584] Other proteins in same PDB: d1bhy_3 complexed with fad |
PDB Entry: 1bhy (more details), 4.18 Å
SCOP Domain Sequences for d1bhy_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bhy_2 c.3.1.5 (276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis} vtklpfipedpriidssgalalkevpgklliigggiiglemgtvystlgsrldvvemmdg lmqgadrdlvkvwqkqneyrfdnimvntktvavepkedgvyvtfeganapkepqrydavl vaagr
Timeline for d1bhy_2: