Lineage for d1bhy_2 (1bhy 276-400)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20948Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)
  6. 20953Protein Dihydrolipoamide dehydrogenase [51959] (6 species)
  7. 20973Species Neisseria meningitidis [TaxId:487] [51964] (2 PDB entries)
  8. 20977Domain d1bhy_2: 1bhy 276-400 [30584]
    Other proteins in same PDB: d1bhy_3

Details for d1bhy_2

PDB Entry: 1bhy (more details), 4.18 Å

PDB Description: low temperature middle resolution structure of p64k from masc data

SCOP Domain Sequences for d1bhy_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhy_2 c.3.1.5 (276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis}
vtklpfipedpriidssgalalkevpgklliigggiiglemgtvystlgsrldvvemmdg
lmqgadrdlvkvwqkqneyrfdnimvntktvavepkedgvyvtfeganapkepqrydavl
vaagr

SCOP Domain Coordinates for d1bhy_2:

Click to download the PDB-style file with coordinates for d1bhy_2.
(The format of our PDB-style files is described here.)

Timeline for d1bhy_2: