![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Domain d1ojta2: 1ojt A:276-400 [30582] Other proteins in same PDB: d1ojta1, d1ojta3 complexed with fad |
PDB Entry: 1ojt (more details), 2.75 Å
SCOPe Domain Sequences for d1ojta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase, middle domain {Neisseria meningitidis [TaxId: 487]} vtklpfipedpriidssgalalkevpgklliigggiiglemgtvystlgsrldvvemmdg lmqgadrdlvkvwqkqneyrfdnimvntktvavepkedgvyvtfeganapkepqrydavl vaagr
Timeline for d1ojta2: