Lineage for d3kkha_ (3kkh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2928976Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2929052Protein Macrophage inflammatory protein, MIP [54128] (5 species)
    has different dimerisation mode
  7. 2929076Species Human (Homo sapiens), 1-beta [TaxId:9606] [54129] (7 PDB entries)
  8. 2929078Domain d3kkha_: 3kkh A: [305710]
    automated match to d1huna_
    complexed with gol

Details for d3kkha_

PDB Entry: 3kkh (more details), 2.6 Å

PDB Description: Human macrophage inflammatory protein-1 beta decamer
PDB Compounds: (A:) macrophage inflammatory protein 1-beta

SCOPe Domain Sequences for d3kkha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kkha_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-beta [TaxId: 9606]}
gsdpptaccfsytarklprnfvvdyyetsslcsqpavvfqtkrskqvcadpseswvqeyv
ydleln

SCOPe Domain Coordinates for d3kkha_:

Click to download the PDB-style file with coordinates for d3kkha_.
(The format of our PDB-style files is described here.)

Timeline for d3kkha_: