Lineage for d1joa_1 (1joa 1-119,243-321)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) 
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins) 
Protein NADH peroxidase [51955] (1 species) Species Enterococcus faecalis [TaxId:1351] [51956] (8 PDB entries) 
Domain d1joa_1: 1joa 1-119,243-321 [30563]
Other proteins in same PDB: d1joa_3
Details for d1joa_1
PDB Entry: 1joa (more details), 2.8 Å
PDB Description: nadh peroxidase with cysteine-sulfenic acid
SCOP Domain Sequences for d1joa_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1joa_1 c.3.1.5 (1-119,243-321) NADH peroxidase {Enterococcus faecalis}
mkvivlgsshggyeaveellnlhpdaeiqwyekgdfisflscgmqlylegkvkdvnsvry
mtgekmesrgvnvfsnteitaiqpkehqvtvkdlvsgeervenydkliispgavpfeldX
gvrpntawlkgtlelhpngliktdeymrtsepdvfavgdatlikynpadtevnialatna
rkqgrfavknleepvkpfp
SCOP Domain Coordinates for d1joa_1:
Click to download the PDB-style file with coordinates for d1joa_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1joa_1:
- d1joa_1 first appeared (with stable ids) in SCOP 1.55
- d1joa_1 appears in SCOP 1.59
- d1joa_1 appears in the current release, SCOPe 2.08, called d1joaa1
View in 3D
