| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
| Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
| Protein NADH peroxidase, N- and C-terminal domain [418946] (1 species) |
| Species Enterococcus faecalis [TaxId:1351] [419402] (8 PDB entries) |
| Domain d1joaa1: 1joa A:1-119,A:243-321 [30563] Other proteins in same PDB: d1joaa2, d1joaa3 complexed with fad has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1joa (more details), 2.8 Å
SCOPe Domain Sequences for d1joaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1joaa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase, N- and C-terminal domain {Enterococcus faecalis [TaxId: 1351]}
mkvivlgsshggyeaveellnlhpdaeiqwyekgdfisflscgmqlylegkvkdvnsvry
mtgekmesrgvnvfsnteitaiqpkehqvtvkdlvsgeervenydkliispgavpfeldX
gvrpntawlkgtlelhpngliktdeymrtsepdvfavgdatlikynpadtevnialatna
rkqgrfavknleepvkpfp
Timeline for d1joaa1: