Lineage for d3j9tg2 (3j9t G:8-97)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2645306Superfamily h.1.36: V-type ATPase peripheral stalk subunit E coiled coil [310578] (1 family) (S)
    Unusual right-handed coiled coil noted in PubMed 20173764
  5. 2645307Family h.1.36.1: V-type ATPase peripheral stalk subunit E coiled coil [310618] (1 protein)
  6. 2645308Protein V-type ATPase peripheral stalk subunit E coiled coil [310711] (2 species)
  7. 2645309Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310949] (3 PDB entries)
  8. 2645313Domain d3j9tg2: 3j9t G:8-97 [305611]
    Other proteins in same PDB: d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9tg1, d3j9th_, d3j9ti1, d3j9tj_, d3j9tk1, d3j9tl_, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2

Details for d3j9tg2

PDB Entry: 3j9t (more details), 6.9 Å

PDB Description: yeast v-atpase state 1
PDB Compounds: (G:) V-type proton ATPase subunit E

SCOPe Domain Sequences for d3j9tg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j9tg2 h.1.36.1 (G:8-97) V-type ATPase peripheral stalk subunit E coiled coil {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ltpnqvndelnkmqafirkeaeekakeiqlkadqeyeiektnivrnetnnidgnfksklk
kamlsqqitkstiankmrlkvlsareqsld

SCOPe Domain Coordinates for d3j9tg2:

Click to download the PDB-style file with coordinates for d3j9tg2.
(The format of our PDB-style files is described here.)

Timeline for d3j9tg2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3j9tg1
View in 3D
Domains from other chains:
(mouse over for more information)
d3j9ta1, d3j9ta2, d3j9ta3, d3j9ta4, d3j9tb1, d3j9tb2, d3j9tb3, d3j9tc1, d3j9tc2, d3j9tc3, d3j9tc4, d3j9td1, d3j9td2, d3j9td3, d3j9te1, d3j9te2, d3j9te3, d3j9te4, d3j9tf1, d3j9tf2, d3j9tf3, d3j9th_, d3j9ti1, d3j9ti2, d3j9tj_, d3j9tk1, d3j9tk2, d3j9tl_, d3j9tm_, d3j9tn_, d3j9to_, d3j9tp_, d3j9tq_, d3j9tr1, d3j9tr2, d3j9ts1, d3j9ts2, d3j9tt1, d3j9tt2, d3j9tu1, d3j9tu2, d3j9tv1, d3j9tv2, d3j9tw1, d3j9tw2, d3j9tx1, d3j9tx2, d3j9ty1, d3j9ty2, d3j9tz1, d3j9tz2