SCOP 1.67: Domain d2npx_2: 2npx 120-242

Lineage for d2npx_2 (2npx 120-242)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (12 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein NADH peroxidase [51955] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [51956] (8 PDB entries)

8. Domain d2npx_2: 2npx 120-242 [30560]
   Other proteins in same PDB: d2npx_3
   complexed with cyo, fad, nad

Details for d2npx_2

PDB Entry: 2npx, 2.4 Å

PDB Description: nadh binding site and catalysis of nadh peroxidase

SCOP Domain Sequences for d2npx_2:

Sequence; same for both SEQRES and ATOM records:

>d2npx_2 c.3.1.5 (120-242) NADH peroxidase {Enterococcus faecalis}
ipgkdldniylmrgrqwaiklkqktvdpevnnvvvigsgyigieaaeafakagkkvtvid
ildrplgvyldkeftdvlteemeannitiatgetveryegdgrvqkvvtdknaydadlvv
vav

Timeline for d2npx_2:

• d2npx_2 first appeared (with stable ids) in SCOP 1.55
  
• d2npx_2 appears in SCOP 1.65
  
• d2npx_2 appears in SCOP 1.69
  
• d2npx_2 appears in the current release, SCOPe 2.08, called d2npxa2