SCOPe 2.06: Domain d3ihhd_: 3ihh D:

Lineage for d3ihhd_ (3ihh D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225826] (7 PDB entries)

8. Domain d3ihhd_: 3ihh D: [305558]
   automated match to d4eb4a_
   complexed with ump

Details for d3ihhd_

PDB Entry: 3ihh, 1.7 Å

PDB Description: Crystal structure of mouse thymidylate synthase in complex with dUMP

PDB Compounds: (D:) Thymidylate synthase

SCOPe Domain Sequences for d3ihhd_:

Sequence; same for both SEQRES and ATOM records:

>d3ihhd_ d.117.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaey
kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
iqlqreprpfpklkilrkvetiddfkvedfqiegynphptikmemav

Timeline for d3ihhd_:

• d3ihhd_ is new in SCOPe 2.06-stable
  
• d3ihhd_ appears in SCOPe 2.07
  
• d3ihhd_ appears in the current release, SCOPe 2.08