Lineage for d3ihhc_ (3ihh C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2579104Protein automated matches [190469] (17 species)
    not a true protein
  7. 2579226Species Mouse (Mus musculus) [TaxId:10090] [225826] (11 PDB entries)
  8. 2579234Domain d3ihhc_: 3ihh C: [305557]
    automated match to d4eb4a_
    complexed with ump

Details for d3ihhc_

PDB Entry: 3ihh (more details), 1.7 Å

PDB Description: Crystal structure of mouse thymidylate synthase in complex with dUMP
PDB Compounds: (C:) Thymidylate synthase

SCOPe Domain Sequences for d3ihhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ihhc_ d.117.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaey
kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
iqlqreprpfpklkilrkvetiddfkvedfqiegynphptikmemav

SCOPe Domain Coordinates for d3ihhc_:

Click to download the PDB-style file with coordinates for d3ihhc_.
(The format of our PDB-style files is described here.)

Timeline for d3ihhc_: