SCOP 1.67: Domain d1nhq_1: 1nhq 1-119,243-321

Lineage for d1nhq_1 (1nhq 1-119,243-321)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (12 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein NADH peroxidase [51955] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [51956] (8 PDB entries)

8. Domain d1nhq_1: 1nhq 1-119,243-321 [30551]
   Other proteins in same PDB: d1nhq_3

Details for d1nhq_1

PDB Entry: 1nhq, 2 Å

PDB Description: crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303

SCOP Domain Sequences for d1nhq_1:

Sequence; same for both SEQRES and ATOM records:

>d1nhq_1 c.3.1.5 (1-119,243-321) NADH peroxidase {Enterococcus faecalis}
mkvivlgsshggyeaveellnlhpdaeiqwyekgdfisflssgmqlylegkvkdvnsvry
mtgekmesrgvnvfsnteitaiqpkehqvtvkdlvsgeervenydkliispgavpfeldX
gvrpntawlkgtlelhpngliktdeymrtsepdvfavgdatlikynpadtevnialatna
rkqgrfavknleepvkpfp

Timeline for d1nhq_1:

• d1nhq_1 first appeared (with stable ids) in SCOP 1.55
  
• d1nhq_1 appears in SCOP 1.65
  
• d1nhq_1 appears in SCOP 1.69
  
• d1nhq_1 appears in the current release, SCOPe 2.08, called d1nhqa1