Lineage for d1nhqa1 (1nhq A:1-119,A:243-321)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2850085Protein NADH peroxidase, N- and C-terminal domain [418946] (1 species)
  7. 2850086Species Enterococcus faecalis [TaxId:1351] [419402] (8 PDB entries)
  8. 2850089Domain d1nhqa1: 1nhq A:1-119,A:243-321 [30551]
    Other proteins in same PDB: d1nhqa2, d1nhqa3
    complexed with fad, so4; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1nhqa1

PDB Entry: 1nhq (more details), 2 Å

PDB Description: crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303
PDB Compounds: (A:) nadh peroxidase

SCOPe Domain Sequences for d1nhqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhqa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase, N- and C-terminal domain {Enterococcus faecalis [TaxId: 1351]}
mkvivlgsshggyeaveellnlhpdaeiqwyekgdfisflssgmqlylegkvkdvnsvry
mtgekmesrgvnvfsnteitaiqpkehqvtvkdlvsgeervenydkliispgavpfeldX
gvrpntawlkgtlelhpngliktdeymrtsepdvfavgdatlikynpadtevnialatna
rkqgrfavknleepvkpfp

SCOPe Domain Coordinates for d1nhqa1:

Click to download the PDB-style file with coordinates for d1nhqa1.
(The format of our PDB-style files is described here.)

Timeline for d1nhqa1: