Lineage for d3h8pa_ (3h8p A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586169Family d.144.1.6: APH phosphotransferases [64411] (5 proteins)
  6. 2586194Protein Type IIIa 3',5"-aminoglycoside phosphotransferase [64412] (1 species)
  7. 2586195Species Enterococcus faecalis [TaxId:1351] [64413] (10 PDB entries)
  8. 2586201Domain d3h8pa_: 3h8p A: [305507]
    automated match to d1j7la_
    complexed with anp, b31, mg

Details for d3h8pa_

PDB Entry: 3h8p (more details), 2.4 Å

PDB Description: Crystal Structure of 3',5"-Aminoglycoside Phosphotransferase Type IIIa AMPPNP Butirosin A Complex
PDB Compounds: (A:) Aminoglycoside 3'-phosphotransferase

SCOPe Domain Sequences for d3h8pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h8pa_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]}
akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek
dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl
fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe
eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf
fdllgikpdwekikyyilldelf

SCOPe Domain Coordinates for d3h8pa_:

Click to download the PDB-style file with coordinates for d3h8pa_.
(The format of our PDB-style files is described here.)

Timeline for d3h8pa_: