Lineage for d3fhsa3 (3fhs A:4-83)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2488217Species Soybean (Glycine max) [TaxId:3847] [225579] (5 PDB entries)
  8. 2488226Domain d3fhsa3: 3fhs A:4-83 [305378]
    Other proteins in same PDB: d3fhsa4, d3fhsb4
    automated match to d4chsb1
    complexed with gsh

Details for d3fhsa3

PDB Entry: 3fhs (more details), 2.71 Å

PDB Description: Glutathione transferase from Glycine max at 2.7 resolution
PDB Compounds: (A:) 2,4-d inducible glutathione s-transferase

SCOPe Domain Sequences for d3fhsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fhsa3 c.47.1.0 (A:4-83) automated matches {Soybean (Glycine max) [TaxId: 3847]}
evvlldfwpspfgmrvrialaekgikyeykeedlrnksplllqmnpvhkkipvlihngkp
icesliavqyieevwndrnp

SCOPe Domain Coordinates for d3fhsa3:

Click to download the PDB-style file with coordinates for d3fhsa3.
(The format of our PDB-style files is described here.)

Timeline for d3fhsa3:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fhsa4