Lineage for d3f55d_ (3f55 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831308Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [189057] (4 PDB entries)
  8. 2831324Domain d3f55d_: 3f55 D: [305354]
    automated match to d4hpga_
    complexed with cac, flc, nag

Details for d3f55d_

PDB Entry: 3f55 (more details), 2.8 Å

PDB Description: Crystal structure of the native endo beta-1,3-glucanase (Hev b 2), A major allergen from hevea brasiliensis (space group P41)
PDB Compounds: (D:) Beta-1,3-glucanase

SCOPe Domain Sequences for d3f55d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f55d_ c.1.8.3 (D:) automated matches {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
evgvcygmqgnnlppvsevialykksnitrmriydpnqavlealrgsnielilgvpnsdl
qsltnpsnakswvqknvrgfwssvrfryiavgneispvnrgtawlaqfvlpamrnihdai
rsaglqdqikvstaidltlvgnsyppsagafrddvrsylnpiirflssirspllaniypy
ftyagnprdislpyalftspsvvvwdgqrgyknlfdatldalysalerasggslevvvse
sgwpsagafaatfdngrtylsnliqhvkrgtpkrpkraietylfamfdenkkqpevekhf
glffpnkwqkynlnfs

SCOPe Domain Coordinates for d3f55d_:

Click to download the PDB-style file with coordinates for d3f55d_.
(The format of our PDB-style files is described here.)

Timeline for d3f55d_: