![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein automated matches [190057] (28 species) not a true protein |
![]() | Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [189057] (4 PDB entries) |
![]() | Domain d3f55c_: 3f55 C: [305353] automated match to d4hpga_ complexed with cac, flc, nag |
PDB Entry: 3f55 (more details), 2.8 Å
SCOPe Domain Sequences for d3f55c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f55c_ c.1.8.3 (C:) automated matches {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} evgvcygmqgnnlppvsevialykksnitrmriydpnqavlealrgsnielilgvpnsdl qsltnpsnakswvqknvrgfwssvrfryiavgneispvnrgtawlaqfvlpamrnihdai rsaglqdqikvstaidltlvgnsyppsagafrddvrsylnpiirflssirspllaniypy ftyagnprdislpyalftspsvvvwdgqrgyknlfdatldalysalerasggslevvvse sgwpsagafaatfdngrtylsnliqhvkrgtpkrpkraietylfamfdenkkqpevekhf glffpnkwqkynlnfs
Timeline for d3f55c_: