Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein Trypanothione reductase [51947] (2 species) |
Species Trypanosoma cruzi [TaxId:5693] [51949] (4 PDB entries) |
Domain d1bzla2: 1bzl A:170-286 [30522] Other proteins in same PDB: d1bzla3, d1bzlb3 complexed with fad, gcg |
PDB Entry: 1bzl (more details), 2.4 Å
SCOPe Domain Sequences for d1bzla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzla2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} ipgiehcissneafylpepprrvltvgggfisvefagifnaykpkdgqvtlcyrgemilr gfdhtlreeltkqltangiqiltkenpakvelnadgsksvtfesgkkmdfdlvmmai
Timeline for d1bzla2: