Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Vibrionales bacterium [TaxId:391574] [267877] (3 PDB entries) |
Domain d3dfhb1: 3dfh B:4-117 [305206] Other proteins in same PDB: d3dfha2, d3dfha3, d3dfhb2, d3dfhb3, d3dfhc2, d3dfhc3 automated match to d3qkea1 complexed with na |
PDB Entry: 3dfh (more details), 2.2 Å
SCOPe Domain Sequences for d3dfhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dfhb1 d.54.1.0 (B:4-117) automated matches {Vibrionales bacterium [TaxId: 391574]} ketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpilig knanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfgg
Timeline for d3dfhb1: