SCOP 1.59: Domain d1tytb1: 1tyt B:2-169,B:287-358

Lineage for d1tytb1 (1tyt B:2-169,B:287-358)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)

6. Protein Trypanothione reductase [51947] (2 species)

7. Species Crithidia fasciculata [TaxId:5656] [51948] (6 PDB entries)

8. Domain d1tytb1: 1tyt B:2-169,B:287-358 [30515]
   Other proteins in same PDB: d1tyta3, d1tytb3

Details for d1tytb1

PDB Entry: 1tyt, 2.6 Å

PDB Description: crystal and molecular structure of crithidia fasciculata trypanothione reductase at 2.6 angstroms resolution

SCOP Domain Sequences for d1tytb1:

Sequence; same for both SEQRES and ATOM records:

>d1tytb1 c.3.1.5 (B:2-169,B:287-358) Trypanothione reductase {Crithidia fasciculata}
sraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpkk
lmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadteglt
fhqgfgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiXrvprsqtlqld
kagvevakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankprat
d

Timeline for d1tytb1:

• d1tytb1 first appeared (with stable ids) in SCOP 1.55
  
• d1tytb1 appears in SCOP 1.57
  
• d1tytb1 appears in SCOP 1.61
  
• d1tytb1 appears in the current release, SCOPe 2.08