Lineage for d2tprb1 (2tpr B:1-168,B:286-357)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67238Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 67403Protein Trypanothione reductase [51947] (2 species)
  7. 67404Species Crithidia fasciculata [TaxId:5656] [51948] (6 PDB entries)
  8. 67423Domain d2tprb1: 2tpr B:1-168,B:286-357 [30507]
    Other proteins in same PDB: d2tpra3, d2tprb3

Details for d2tprb1

PDB Entry: 2tpr (more details), 2.4 Å

PDB Description: x-ray structure of trypanothione reductase from crithidia fasciculata at 2.4 angstroms resolution

SCOP Domain Sequences for d2tprb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tprb1 c.3.1.5 (B:1-168,B:286-357) Trypanothione reductase {Crithidia fasciculata}
sraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpkk
lmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadteglt
fhqgfgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiXrvprsqtlqle
kagvevakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankprat
d

SCOP Domain Coordinates for d2tprb1:

Click to download the PDB-style file with coordinates for d2tprb1.
(The format of our PDB-style files is described here.)

Timeline for d2tprb1: