Lineage for d2tprb1 (2tpr B:1-168,B:286-357)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2850224Protein Trypanothione reductase, N- and C-terminal domain [418954] (3 species)
  7. 2850225Species Crithidia fasciculata [TaxId:5656] [419410] (6 PDB entries)
  8. 2850235Domain d2tprb1: 2tpr B:1-168,B:286-357 [30507]
    Other proteins in same PDB: d2tpra2, d2tpra3, d2tprb2, d2tprb3
    complexed with fad
    has additional insertions and/or extensions that are not grouped together

Details for d2tprb1

PDB Entry: 2tpr (more details), 2.4 Å

PDB Description: x-ray structure of trypanothione reductase from crithidia fasciculata at 2.4 angstroms resolution
PDB Compounds: (B:) trypanothione reductase

SCOPe Domain Sequences for d2tprb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tprb1 c.3.1.5 (B:1-168,B:286-357) Trypanothione reductase, N- and C-terminal domain {Crithidia fasciculata [TaxId: 5656]}
sraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpkk
lmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadteglt
fhqgfgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiXrvprsqtlqle
kagvevakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankprat
d

SCOPe Domain Coordinates for d2tprb1:

Click to download the PDB-style file with coordinates for d2tprb1.
(The format of our PDB-style files is described here.)

Timeline for d2tprb1: