![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Protein Trypanothione reductase, N- and C-terminal domain [418954] (3 species) |
![]() | Species Crithidia fasciculata [TaxId:5656] [419410] (6 PDB entries) |
![]() | Domain d2tprb1: 2tpr B:1-168,B:286-357 [30507] Other proteins in same PDB: d2tpra2, d2tpra3, d2tprb2, d2tprb3 complexed with fad has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2tpr (more details), 2.4 Å
SCOPe Domain Sequences for d2tprb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tprb1 c.3.1.5 (B:1-168,B:286-357) Trypanothione reductase, N- and C-terminal domain {Crithidia fasciculata [TaxId: 5656]} sraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpkk lmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadteglt fhqgfgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiXrvprsqtlqle kagvevakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankprat d
Timeline for d2tprb1: