![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Protein Trypanothione reductase [51947] (2 species) |
![]() | Species Crithidia fasciculata [TaxId:5656] [51948] (6 PDB entries) |
![]() | Domain d1feaa2: 1fea A:170-286 [30498] Other proteins in same PDB: d1feaa3, d1feab3, d1feac3, d1fead3 complexed with fad |
PDB Entry: 1fea (more details), 2.2 Å
SCOPe Domain Sequences for d1feaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1feaa2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} gddlcitsneafyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgf dselrkqlteqlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigr
Timeline for d1feaa2: