Lineage for d1febb1 (1feb B:1-169,B:287-357)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1351449Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1351450Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1351953Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 1352234Protein Trypanothione reductase [51947] (2 species)
  7. 1352235Species Crithidia fasciculata [TaxId:5656] [51948] (6 PDB entries)
  8. 1352242Domain d1febb1: 1feb B:1-169,B:287-357 [30495]
    Other proteins in same PDB: d1feba3, d1febb3
    complexed with fad

Details for d1febb1

PDB Entry: 1feb (more details), 2 Å

PDB Description: unliganded crithidia fasciculata trypanothione reductase at 2.0 angstrom resolution
PDB Compounds: (B:) trypanothione reductase

SCOPe Domain Sequences for d1febb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1febb1 c.3.1.5 (B:1-169,B:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}
sraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpkk
lmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadteglt
fhqgfgalqdnhtvlvresadpnsavletldteyillatgswpqhlgieXvprsqtlqle
kagvevakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankprat
d

SCOPe Domain Coordinates for d1febb1:

Click to download the PDB-style file with coordinates for d1febb1.
(The format of our PDB-style files is described here.)

Timeline for d1febb1: