SCOP 1.73: Domain d1getb2: 1get B:147-262

Lineage for d1getb2 (1get B:147-262)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Glutathione reductase [51944] (3 species)

7. Species Escherichia coli [TaxId:562] [51946] (4 PDB entries)

8. Domain d1getb2: 1get B:147-262 [30484]
   Other proteins in same PDB: d1geta3, d1getb3
   complexed with fad, nap

Details for d1getb2

PDB Entry: 1get, 2 Å

PDB Description: anatomy of an engineered nad-binding site

PDB Compounds: (B:) glutathione reductase

SCOP Domain Sequences for d1getb2:

Sequence; same for both SEQRES and ATOM records:

>d1getb2 c.3.1.5 (B:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]}
dipgveygidsdgffalpalpervavvgagyiavelagvinglgakthlfvrkhaplrsf
dpmisetlvevmnaegpqlhtnaipkavvkntdgsltleledgrsetvdcliwaig

Timeline for d1getb2:

• d1getb2 first appeared (with stable ids) in SCOP 1.55
  
• d1getb2 appears in SCOP 1.71
  
• d1getb2 appears in SCOP 1.75
  
• d1getb2 appears in the current release, SCOPe 2.08