Lineage for d2xzha1 (2xzh A:1-330)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418863Superfamily b.69.6: Clathrin heavy-chain terminal domain [50989] (1 family) (S)
  5. 2418864Family b.69.6.1: Clathrin heavy-chain terminal domain [50990] (2 proteins)
  6. 2418877Protein automated matches [227067] (1 species)
    not a true protein
  7. 2418878Species Human (Homo sapiens) [TaxId:9606] [226191] (6 PDB entries)
  8. 2418880Domain d2xzha1: 2xzh A:1-330 [304680]
    Other proteins in same PDB: d2xzha2, d2xzha3
    automated match to d1utca2
    complexed with act, dms, edo, peg, vh2

Details for d2xzha1

PDB Entry: 2xzh (more details), 1.69 Å

PDB Description: Clathrin Terminal Domain Complexed with Pitstop 2
PDB Compounds: (A:) Clathrin heavy chain 1

SCOPe Domain Sequences for d2xzha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xzha1 b.69.6.1 (A:1-330) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
etifvtapheatagiigvnrkgqvlsvcve

SCOPe Domain Coordinates for d2xzha1:

Click to download the PDB-style file with coordinates for d2xzha1.
(The format of our PDB-style files is described here.)

Timeline for d2xzha1: