SCOPe 2.06: Domain d2qvqa_: 2qvq A:

Lineage for d2qvqa_ (2qvq A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49420] (40 PDB entries)

8. Domain d2qvqa_: 2qvq A: [304438]
   automated match to d4lofa_
   complexed with zn; mutant

Details for d2qvqa_

PDB Entry: 2qvq, 2 Å

PDB Description: Human p53 Core Domain Mutant V157F/N235K/N239Y

PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2qvqa_:

Sequence; same for both SEQRES and ATOM records:

>d2qvqa_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
gtrframaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
hsvvvpyeppevgsdcttihykymcysscmggmnrrpiltiitledssgnllgrnsfevr
vcacpgrdrrteeenl

Timeline for d2qvqa_:

• d2qvqa_ is new in SCOPe 2.06-stable
  
• d2qvqa_ appears in SCOPe 2.07
  
• d2qvqa_ appears in the current release, SCOPe 2.08