Lineage for d2pz4a1 (2pz4 A:1-120)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2379615Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) (S)
  5. 2379616Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins)
    Pfam PF05738
  6. 2379674Protein automated matches [310857] (1 species)
    not a true protein
  7. 2379675Species Streptococcus agalactiae [TaxId:1311] [311237] (1 PDB entry)
  8. 2379676Domain d2pz4a1: 2pz4 A:1-120 [304388]
    Other proteins in same PDB: d2pz4a3
    automated match to d3phsa1

Details for d2pz4a1

PDB Entry: 2pz4 (more details), 1.8 Å

PDB Description: Crystal Structure of SpaB (GBS52), the minor pilin in gram-positive pathogen Streptococcus agalactiae
PDB Compounds: (A:) protein gbs052

SCOPe Domain Sequences for d2pz4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pz4a1 b.3.5.1 (A:1-120) automated matches {Streptococcus agalactiae [TaxId: 1311]}
hqltivhleardidrpnpqleiapkegtpiegvlyqlyqlkstedgdllahwnsltitel
kkqaqqvfeattnqqgkatfnqlpdgiyyglavkageknrnvsaflvdlsedkviypkii

SCOPe Domain Coordinates for d2pz4a1:

Click to download the PDB-style file with coordinates for d2pz4a1.
(The format of our PDB-style files is described here.)

Timeline for d2pz4a1: