Lineage for d2pslb_ (2psl B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2546828Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2546832Protein Green fluorescent protein, GFP [54513] (5 species)
  7. 2547228Species Renilla reniformis [TaxId:6136] [160126] (2 PDB entries)
    Uniprot Q963I9 7-226
  8. 2547234Domain d2pslb_: 2psl B: [304375]
    automated match to d2vzxc_

Details for d2pslb_

PDB Entry: 2psl (more details), 1.5 Å

PDB Description: Crystal Structures of the Luciferase and Green Fluorescent Protein from Renilla Reniformis
PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d2pslb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pslb_ d.22.1.1 (B:) Green fluorescent protein, GFP {Renilla reniformis [TaxId: 6136]}
glkevmptkinleglvgdhafsmegvgegnilegtqevkisvtkgaplpfafdivsvafs
ygnraytgypeeisdyflqsfpegftyerniryqdggtaivksdisledgkfivnvdfka
kdlrrmgpvmqqdivgmqpsyesmytnvtsvigeciiafklqtgkhftyhmrtvykskkp
vetmplyhfiqhrlvktnvdtasgyvvqhetaiaahstik

SCOPe Domain Coordinates for d2pslb_:

Click to download the PDB-style file with coordinates for d2pslb_.
(The format of our PDB-style files is described here.)

Timeline for d2pslb_: