Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein Green fluorescent protein, GFP [54513] (5 species) |
Species Renilla reniformis [TaxId:6136] [160126] (2 PDB entries) Uniprot Q963I9 7-226 |
Domain d2pslb_: 2psl B: [304375] automated match to d2vzxc_ |
PDB Entry: 2psl (more details), 1.5 Å
SCOPe Domain Sequences for d2pslb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pslb_ d.22.1.1 (B:) Green fluorescent protein, GFP {Renilla reniformis [TaxId: 6136]} glkevmptkinleglvgdhafsmegvgegnilegtqevkisvtkgaplpfafdivsvafs ygnraytgypeeisdyflqsfpegftyerniryqdggtaivksdisledgkfivnvdfka kdlrrmgpvmqqdivgmqpsyesmytnvtsvigeciiafklqtgkhftyhmrtvykskkp vetmplyhfiqhrlvktnvdtasgyvvqhetaiaahstik
Timeline for d2pslb_: