Lineage for d2p3rb4 (2p3r B:254-500)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884335Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 2884336Protein Glycerol kinase [53090] (2 species)
  7. 2884378Species Escherichia coli [TaxId:562] [53091] (14 PDB entries)
  8. 2884382Domain d2p3rb4: 2p3r B:254-500 [304315]
    Other proteins in same PDB: d2p3rb5, d2p3rg5
    automated match to d3ezwe2
    complexed with gol; mutant

Details for d2p3rb4

PDB Entry: 2p3r (more details), 2 Å

PDB Description: Crystal structure of a hyperactive Escherichia coli glycerol kinase mutant Gly230->Asp obtained using microfluidic crystallization devices
PDB Compounds: (B:) glycerol kinase

SCOPe Domain Sequences for d2p3rb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p3rb4 c.55.1.4 (B:254-500) Glycerol kinase {Escherichia coli [TaxId: 562]}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweehd

SCOPe Domain Coordinates for d2p3rb4:

Click to download the PDB-style file with coordinates for d2p3rb4.
(The format of our PDB-style files is described here.)

Timeline for d2p3rb4: