Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.0: automated matches [227243] (1 protein) not a true family |
Protein automated matches [227009] (15 species) not a true protein |
Species Escherichia coli [311232] (2 PDB entries) |
Domain d2o9mb_: 2o9m B: [304265] automated match to d3o1kb_ complexed with ph2 |
PDB Entry: 2o9m (more details), 2.45 Å
SCOPe Domain Sequences for d2o9mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o9mb_ d.96.1.0 (B:) automated matches {Escherichia coli} mdivfieqlsvittigvydweqtieqklvfdiemawdnrkaaksddvadclsyadiaetv vshvegarfalvervaeevaelllarfnspwvriklskpgavaraanvgviiergnnlke
Timeline for d2o9mb_: