Lineage for d2mnua_ (2mnu A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762155Protein automated matches [190888] (2 species)
    not a true protein
  7. 2762158Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries)
  8. 2762236Domain d2mnua_: 2mnu A: [304205]
    automated match to d2fnba_

Details for d2mnua_

PDB Entry: 2mnu (more details)

PDB Description: Backbone and side chain 1H, 13C, and 15N Chemical Shift Assignments for EDB and specific binding aptide
PDB Compounds: (A:) edb

SCOPe Domain Sequences for d2mnua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mnua_ b.1.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsevpqltdlsfvditdssiglrwtplnsstiigyritvvaagegipifedfvdssvgyy
tvtglepgidydisvitlinggesapttltqqt

SCOPe Domain Coordinates for d2mnua_:

Click to download the PDB-style file with coordinates for d2mnua_.
(The format of our PDB-style files is described here.)

Timeline for d2mnua_: