Lineage for d2ljpa_ (2ljp A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2538081Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2538082Protein automated matches [190826] (22 species)
    not a true protein
  7. 2538167Species Escherichia coli [TaxId:83333] [271300] (6 PDB entries)
  8. 2538173Domain d2ljpa_: 2ljp A: [304184]
    automated match to d1d6ta_

Details for d2ljpa_

PDB Entry: 2ljp (more details)

PDB Description: Backbone 1H, 13C, and 15N Chemical Shift Assignments for E.coli Ribonuclease P protein
PDB Compounds: (A:) Ribonuclease P protein component

SCOPe Domain Sequences for d2ljpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ljpa_ d.14.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
mvklafprelrlltpsqftfvfqqpqragtpqitilgrlnslghprigltvakknvrrah
ernrikrltresfrlrqhelpamdfvvvakkgvadldnralsealeklwrrhcrlargs

SCOPe Domain Coordinates for d2ljpa_:

Click to download the PDB-style file with coordinates for d2ljpa_.
(The format of our PDB-style files is described here.)

Timeline for d2ljpa_: