Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein STE20-like serine/threonine-protein kinase, SLK [160812] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [160813] (5 PDB entries) Uniprot Q9H2G2 21-308 |
Domain d2ja0a_: 2ja0 A: [304107] automated match to d2uv2a1 complexed with edo, hqp, scn |
PDB Entry: 2ja0 (more details), 2.3 Å
SCOPe Domain Sequences for d2ja0a_:
Sequence, based on SEQRES records: (download)
>d2ja0a_ d.144.1.7 (A:) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} yehvtrdlnpedfweiigelgdgafgkvykaqnketsvlaaakvidtkseeeledymvei dilascdhpnivklldafyyennlwiliefcaggavdavmlelerpltesqiqvvckqtl dalnylhdnkiihrdlkagnilftldgdikladfgvsakntrtiqrrdsfigtpywmape vvmcetskdrpydykadvwslgitliemaeiepphhelnpmrvllkiaksepptlaqpsr wssnfkdflkkcleknvdarwttsqllqhpfvtvdsnkpireliaeak
>d2ja0a_ d.144.1.7 (A:) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} yehvtrdlnpedfweiigelgdfgkvykaqnketsvlaaakvidtkseeeledymveidi lascdhpnivklldafyyennlwiliefcaggavdavmlelerpltesqiqvvckqtlda lnylhdnkiihrdlkagnilftldgdikladfgvsakntrtiqrrdsfigtpywmapevv mcetskdrpydykadvwslgitliemaeiepphhelnpmrvllkiaksepptlaqpsrws snfkdflkkcleknvdarwttsqllqhpfvtvdsnkpireliaeak
Timeline for d2ja0a_: