Lineage for d2iq8b2 (2iq8 B:185-264)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954092Family d.58.18.3: Phenylalanine metabolism regulatory domain [55028] (2 proteins)
  6. 2954097Protein Prephenate dehydratase C-terminal domain [160320] (1 species)
  7. 2954098Species Staphylococcus aureus [TaxId:1280] [160321] (2 PDB entries)
    Uniprot Q99SX2 185-264
  8. 2954102Domain d2iq8b2: 2iq8 B:185-264 [304081]
    Other proteins in same PDB: d2iq8a1, d2iq8b1
    automated match to d2qmwa2
    complexed with act, edo, mg, peg

Details for d2iq8b2

PDB Entry: 2iq8 (more details), 2.3 Å

PDB Description: The crystal structure of putative prephenate dehydratase from Staphylococcus aureus subsp. aureus Mu50
PDB Compounds: (B:) Putative prephenate dehydratase

SCOPe Domain Sequences for d2iq8b2:

Sequence, based on SEQRES records: (download)

>d2iq8b2 d.58.18.3 (B:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
slmflitpmhdkpgllasvlntfalfninlswiesrplktqlgmyrffvqadsaittdik
kviailetldfkvemigafn

Sequence, based on observed residues (ATOM records): (download)

>d2iq8b2 d.58.18.3 (B:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
slmflitpmhdkpgllasvlntfalfninlswiesrpgmyrffvqadsaittdikkviai
letldfkvemigafn

SCOPe Domain Coordinates for d2iq8b2:

Click to download the PDB-style file with coordinates for d2iq8b2.
(The format of our PDB-style files is described here.)

Timeline for d2iq8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iq8b1