Lineage for d2iq8a1 (2iq8 A:1-184)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914610Protein Prephenate dehydratase [159808] (1 species)
  7. 2914611Species Staphylococcus aureus [TaxId:1280] [159809] (2 PDB entries)
    Uniprot Q99SX2 1-184
  8. 2914614Domain d2iq8a1: 2iq8 A:1-184 [304078]
    Other proteins in same PDB: d2iq8a2, d2iq8b2
    automated match to d2qmwa1
    complexed with act, edo, mg, peg

    missing some secondary structures that made up less than one-third of the common domain

Details for d2iq8a1

PDB Entry: 2iq8 (more details), 2.3 Å

PDB Description: The crystal structure of putative prephenate dehydratase from Staphylococcus aureus subsp. aureus Mu50
PDB Compounds: (A:) Putative prephenate dehydratase

SCOPe Domain Sequences for d2iq8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iq8a1 c.94.1.1 (A:1-184) Prephenate dehydratase {Staphylococcus aureus [TaxId: 1280]}
mqlyylgpkgtfsylacrqyfseneatfqpksnlfevikavadddtsigvvpiensiegt
inivadalaqqdvfahgeirldinfalygngtdsisdikkvysiapaisqttnyihqhqf
dydyvdstiqsltkiengvaaiaplgsgeaygftpidthiedyphnvtrflviknqqqfd
qnat

SCOPe Domain Coordinates for d2iq8a1:

Click to download the PDB-style file with coordinates for d2iq8a1.
(The format of our PDB-style files is described here.)

Timeline for d2iq8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iq8a2