![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
![]() | Protein automated matches [196409] (46 species) not a true protein |
![]() | Species Cryptosporidium parvum [TaxId:5807] [255516] (2 PDB entries) |
![]() | Domain d2hera_: 2her A: [303965] automated match to d2q58b_ complexed with mg, zol |
PDB Entry: 2her (more details), 2.37 Å
SCOPe Domain Sequences for d2hera_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hera_ a.128.1.0 (A:) automated matches {Cryptosporidium parvum [TaxId: 5807]} ydytdfinyydkfkvivynvlkklplndeirkpvieyylncidynvkkgkhirgkilvli sslssaysnikrdsiyllgwvveaiqaliliaddimdsgkfrrgapcwyivhgqsnaind ifflkmlslslifelssvfgndivmkiqkiynesifftvlgqhldlsyfdlskadkiser yfsmvemktsrytfympvffgltlseiqvssaqlnlieailyklgefyqvhndvsdylfn dsnaddicrfkltwplqksfeiadeemklkisenygknsslvkdcynllkinehyleyqr naldyliklvkditddslqkvfihlihqiselitn
Timeline for d2hera_: