SCOPe 2.08: Domain d2hera_: 2her A:

Lineage for d2hera_ (2her A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (46 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:5807] [255516] (2 PDB entries)

8. Domain d2hera_: 2her A: [303965]
   automated match to d2q58b_
   complexed with mg, zol

Details for d2hera_

PDB Entry: 2her, 2.37 Å

PDB Description: Cryptosporidium parvum putative polyprenyl pyrophosphate synthase (cgd4_2550) in complex with zoledronate

PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d2hera_:

Sequence; same for both SEQRES and ATOM records:

>d2hera_ a.128.1.0 (A:) automated matches {Cryptosporidium parvum [TaxId: 5807]}
ydytdfinyydkfkvivynvlkklplndeirkpvieyylncidynvkkgkhirgkilvli
sslssaysnikrdsiyllgwvveaiqaliliaddimdsgkfrrgapcwyivhgqsnaind
ifflkmlslslifelssvfgndivmkiqkiynesifftvlgqhldlsyfdlskadkiser
yfsmvemktsrytfympvffgltlseiqvssaqlnlieailyklgefyqvhndvsdylfn
dsnaddicrfkltwplqksfeiadeemklkisenygknsslvkdcynllkinehyleyqr
naldyliklvkditddslqkvfihlihqiselitn

Timeline for d2hera_:

• d2hera_ first appeared in SCOPe 2.06
  
• d2hera_ appears in SCOPe 2.07