Lineage for d2hera_ (2her A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337561Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2337562Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2337969Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2337970Protein automated matches [196409] (38 species)
    not a true protein
  7. 2338002Species Cryptosporidium parvum [TaxId:5807] [255516] (2 PDB entries)
  8. 2338005Domain d2hera_: 2her A: [303965]
    automated match to d2q58b_
    complexed with mg, zol

Details for d2hera_

PDB Entry: 2her (more details), 2.37 Å

PDB Description: Cryptosporidium parvum putative polyprenyl pyrophosphate synthase (cgd4_2550) in complex with zoledronate
PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d2hera_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hera_ a.128.1.0 (A:) automated matches {Cryptosporidium parvum [TaxId: 5807]}
ydytdfinyydkfkvivynvlkklplndeirkpvieyylncidynvkkgkhirgkilvli
sslssaysnikrdsiyllgwvveaiqaliliaddimdsgkfrrgapcwyivhgqsnaind
ifflkmlslslifelssvfgndivmkiqkiynesifftvlgqhldlsyfdlskadkiser
yfsmvemktsrytfympvffgltlseiqvssaqlnlieailyklgefyqvhndvsdylfn
dsnaddicrfkltwplqksfeiadeemklkisenygknsslvkdcynllkinehyleyqr
naldyliklvkditddslqkvfihlihqiselitn

SCOPe Domain Coordinates for d2hera_:

Click to download the PDB-style file with coordinates for d2hera_.
(The format of our PDB-style files is described here.)

Timeline for d2hera_: