Lineage for d2gnrb_ (2gnr B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790379Family b.40.4.15: SSO2064-like [159109] (1 protein)
    Pfam PF01796; DUF35; contains extra N-terminal zinc finger subdomain of the rubredoxin-like fold
  6. 2790380Protein Hypothetical protein SSO2064 [159110] (1 species)
  7. 2790381Species Sulfolobus solfataricus [TaxId:2287] [159111] (2 PDB entries)
    Uniprot Q97WQ4 8-144
  8. 2790383Domain d2gnrb_: 2gnr B: [303932]
    automated match to d3irba_
    complexed with acy, so4, zn

Details for d2gnrb_

PDB Entry: 2gnr (more details), 1.8 Å

PDB Description: Crystal structure of a protein with unknown function from DUF35 family (13815350) from Sulfolobus solfataricus at 1.80 A resolution
PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d2gnrb_:

Sequence, based on SEQRES records: (download)

>d2gnrb_ b.40.4.15 (B:) Hypothetical protein SSO2064 {Sulfolobus solfataricus [TaxId: 2287]}
gsllrwydvmeaeryeytvgpageqffnglkqnkiigskcskcgrifvparsycehcfvk
ienyveinkdeayvdsytiiynddegnklaqpvyialirfpnieggllcyaegnvkvgak
akilsfqwplrvkvd

Sequence, based on observed residues (ATOM records): (download)

>d2gnrb_ b.40.4.15 (B:) Hypothetical protein SSO2064 {Sulfolobus solfataricus [TaxId: 2287]}
gsllrwydvmeaeryeytgpageqffnglkqnkiigskcskcgrifvparsycehcfvki
enyveinkdeayvdsytiiynddegnklaqpvyialirfpnieggllcyaegnvkvgaka
kilsfqwplrvkvd

SCOPe Domain Coordinates for d2gnrb_:

Click to download the PDB-style file with coordinates for d2gnrb_.
(The format of our PDB-style files is described here.)

Timeline for d2gnrb_: