Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Plasmodium yoelii [311205] (1 PDB entry) |
Domain d2fegb1: 2feg B:8-175 [303823] Other proteins in same PDB: d2fega2, d2fegb2 automated match to d2i81b_ complexed with cl, edo |
PDB Entry: 2feg (more details), 2.29 Å
SCOPe Domain Sequences for d2fegb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fegb1 c.47.1.0 (B:8-175) automated matches {Plasmodium yoelii} qapsfkaeavfgdntfgevslsdfigkkyvllyfypldftfvcpseiialdkaldsfker nvellgcsvdskfthlawkktplsqggignikhtlisdisksiarsydvlfnesvalraf vlidkqgvvqhllvnnlalgrsvdeilrlidalqhhekygdvcpanwq
Timeline for d2fegb1: