Lineage for d2fegb1 (2feg B:8-175)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2488068Species Plasmodium yoelii [311205] (1 PDB entry)
  8. 2488070Domain d2fegb1: 2feg B:8-175 [303823]
    Other proteins in same PDB: d2fega2, d2fegb2
    automated match to d2i81b_
    complexed with cl, edo

Details for d2fegb1

PDB Entry: 2feg (more details), 2.29 Å

PDB Description: PY00414- Plasmodium yoelii thioredoxin peroxidase I
PDB Compounds: (B:) 2-cys peroxiredoxin

SCOPe Domain Sequences for d2fegb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fegb1 c.47.1.0 (B:8-175) automated matches {Plasmodium yoelii}
qapsfkaeavfgdntfgevslsdfigkkyvllyfypldftfvcpseiialdkaldsfker
nvellgcsvdskfthlawkktplsqggignikhtlisdisksiarsydvlfnesvalraf
vlidkqgvvqhllvnnlalgrsvdeilrlidalqhhekygdvcpanwq

SCOPe Domain Coordinates for d2fegb1:

Click to download the PDB-style file with coordinates for d2fegb1.
(The format of our PDB-style files is described here.)

Timeline for d2fegb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fegb2