Lineage for d1foha5 (1foh A:1-240,A:342-461)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849379Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2849647Protein Phenol hydroxylase [51922] (1 species)
    structurally very similar to PHBH, but contains additional C-terminal domain of the thioredoxin-like fold
  7. 2849648Species Soil-living yeast (Trichosporon cutaneum) [TaxId:5554] [51923] (2 PDB entries)
  8. 2849653Domain d1foha5: 1foh A:1-240,A:342-461 [30381]
    Other proteins in same PDB: d1foha3, d1foha4, d1fohb3, d1fohb4, d1fohc3, d1fohc4, d1fohd3, d1fohd4
    complexed with fad, iph

Details for d1foha5

PDB Entry: 1foh (more details), 2.4 Å

PDB Description: phenol hydroxylase from trichosporon cutaneum
PDB Compounds: (A:) phenol hydroxylase

SCOPe Domain Sequences for d1foha5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1foha5 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]}
tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt
leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri
erhildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsdhestplqfg
hktenslfhsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi
Xvtekfskdervfiagdachthspkagqgmntsmmdtynlgwklglvltgrakrdilkty
eeerhafaqalidfdhqfsrlfsgrpakdvademgvsmdvfkeafvkgnefasgtainyd
e

SCOPe Domain Coordinates for d1foha5:

Click to download the PDB-style file with coordinates for d1foha5.
(The format of our PDB-style files is described here.)

Timeline for d1foha5: