| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein Phenol hydroxylase, C-terminal domain [52911] (1 species) |
| Species Soil-living yeast (Trichosporon cutaneum) [TaxId:5554] [52912] (2 PDB entries) |
| Domain d1fohb3: 1foh B:462-664 [33079] Other proteins in same PDB: d1foha4, d1foha5, d1fohb4, d1fohb5, d1fohc4, d1fohc5, d1fohd4, d1fohd5 complexed with fad, iph |
PDB Entry: 1foh (more details), 2.4 Å
SCOPe Domain Sequences for d1fohb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fohb3 c.47.1.10 (B:462-664) Phenol hydroxylase, C-terminal domain {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]}
nlvtdkksskqelakncvvgtrfksqpvvrhseglwmhfgdrlvtdgrfriivfagkatd
atqmsrikkfsayldsensvislytpkvsdrnsridvitihschrddiemhdfpapalhp
kwqydfiyadcdswhhphpksyqawgvdetkgavvvvrpdgytslvtdlegtaeidryfs
gilvepkeksgaqteadwtksta
Timeline for d1fohb3: