Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (21 species) not a true protein |
Species Fungia concinna [TaxId:496660] [193728] (8 PDB entries) |
Domain d2ejia_: 2eji A: [303783] automated match to d2zo7a_ mutant |
PDB Entry: 2eji (more details), 1.58 Å
SCOPe Domain Sequences for d2ejia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ejia_ d.22.1.0 (A:) automated matches {Fungia concinna [TaxId: 496660]} ptmvsvikpemkmryymdgsvngheftvegegtgrpyegkqkitldvtkggplpfafdll stvfsygnraltkypddipdyfkqcfpggyswerkfefedgglaiakaeislkgncfehk stiegtfpdsspimqnktlgwepstekmtvrdgsmkgddasylklvgggnhkcyftttyt akkkipnlpgshfighrissvvegtkikvmedaiahlypfng
Timeline for d2ejia_: