Lineage for d2ejia_ (2eji A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184480Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2184481Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2185154Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2185155Protein automated matches [190526] (21 species)
    not a true protein
  7. 2185393Species Fungia concinna [TaxId:496660] [193728] (8 PDB entries)
  8. 2185396Domain d2ejia_: 2eji A: [303783]
    automated match to d2zo7a_
    mutant

Details for d2ejia_

PDB Entry: 2eji (more details), 1.58 Å

PDB Description: Crystal structure of a kusabira-cyan mutant (KCy-R1), a cyan/green-emitting GFP-like protein
PDB Compounds: (A:) Cyan/Green-emitting GFP-like protein, Kusabira-Cyan mutant (KCy-R1)

SCOPe Domain Sequences for d2ejia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ejia_ d.22.1.0 (A:) automated matches {Fungia concinna [TaxId: 496660]}
ptmvsvikpemkmryymdgsvngheftvegegtgrpyegkqkitldvtkggplpfafdll
stvfsygnraltkypddipdyfkqcfpggyswerkfefedgglaiakaeislkgncfehk
stiegtfpdsspimqnktlgwepstekmtvrdgsmkgddasylklvgggnhkcyftttyt
akkkipnlpgshfighrissvvegtkikvmedaiahlypfng

SCOPe Domain Coordinates for d2ejia_:

Click to download the PDB-style file with coordinates for d2ejia_.
(The format of our PDB-style files is described here.)

Timeline for d2ejia_: