Lineage for d1el8b1 (1el8 B:1-217,B:322-385)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1351449Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1351450Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1351504Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 1351805Protein Sarcosine oxidase [51920] (1 species)
  7. 1351806Species Bacillus sp., strain b0618 [TaxId:1409] [51921] (16 PDB entries)
  8. 1351830Domain d1el8b1: 1el8 B:1-217,B:322-385 [30374]
    Other proteins in same PDB: d1el8a2, d1el8b2
    complexed with cl, fad, msf, po4

Details for d1el8b1

PDB Entry: 1el8 (more details), 1.9 Å

PDB Description: complex of monomeric sarcosine oxidase with the inhibitor [methylseleno]cetate
PDB Compounds: (B:) sarcosine oxidase

SCOPe Domain Sequences for d1el8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1el8b1 c.3.1.2 (B:1-217,B:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
dsvkietangsytadklivsmgawnskllsklnldipXdehfiidlhpehsnvviaagfs
ghgfkfssgvgevlsqlaltgktehdisifsinrpalkeslq

SCOPe Domain Coordinates for d1el8b1:

Click to download the PDB-style file with coordinates for d1el8b1.
(The format of our PDB-style files is described here.)

Timeline for d1el8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1el8b2