Lineage for d1el7a1 (1el7 A:1-217,A:322-385)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176176Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 176177Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 176224Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (8 proteins)
  6. 176326Protein Sarcosine oxidase [51920] (1 species)
  7. 176327Species Bacillus sp., strain b0618 [TaxId:1409] [51921] (6 PDB entries)
  8. 176336Domain d1el7a1: 1el7 A:1-217,A:322-385 [30371]
    Other proteins in same PDB: d1el7a2, d1el7b2

Details for d1el7a1

PDB Entry: 1el7 (more details), 1.9 Å

PDB Description: complex of monomeric sarcosine oxidase with the inhibitor [methytelluro]acetate

SCOP Domain Sequences for d1el7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1el7a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618}
sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
dsvkietangsytadklivsmgawnskllsklnldipXdehfiidlhpehsnvviaagfs
ghgfkfssgvgevlsqlaltgktehdisifsinrpalkeslq

SCOP Domain Coordinates for d1el7a1:

Click to download the PDB-style file with coordinates for d1el7a1.
(The format of our PDB-style files is described here.)

Timeline for d1el7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1el7a2